PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01013107001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family HSF
Protein Properties Length: 89aa    MW: 10334.7 Da    PI: 10.3177
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01013107001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.49.8e-24168979
                       HHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE---SSBTTTTXTTSE CS
       HSF_DNA-bind  9 iledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkdeekkskskekiw 79
                       +++d+++++++sws ++nsfvv+++ efa+++LpkyFkh+nf+SFvRQLn+Y  k     ek+   kek  
  GSVIVT01013107001  1 MVDDPATNSIVSWSPTNNSFVVWNPPEFARDLLPKYFKHNNFSSFVRQLNTYHPKTEVGMEKQ---KEKKA 68
                       899***********999***********************************86655444444...33334 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004151.4E-20183IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467856.39E-22153IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004471.4E-20169IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE profilePS500618.648171IPR000418Ets domain
Gene3DG3DSA:1.10.10.101.0E-24170IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000563.1E-63244IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.1E-64557IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MVDDPATNSI VSWSPTNNSF VVWNPPEFAR DLLPKYFKHN NFSSFVRQLN TYHPKTEVGM  60
EKQKEKKARF RDSGRLIQTV GNLQMRDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D3e-181623697Heat shock factor protein 1
5d5v_B3e-181623697Heat shock factor protein 1
5d5u_B3e-181623697Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3922541e-147FQ392254.1 Vitis vinifera clone SS0AFA6YK04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631489.14e-30PREDICTED: heat shock factor protein HSF8
SwissprotQ401522e-29HSF8_SOLLC; Heat shock factor protein HSF8
SwissprotP411532e-29HSF8_SOLPE; Heat shock factor protein HSF8
TrEMBLA5AGK23e-30A5AGK2_VITVI; Putative uncharacterized protein
STRINGVIT_02s0012g01810.t011e-29(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9617233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.13e-30heat shock factor 1